SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125974634|ref|YP_001038544.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125974634|ref|YP_001038544.1|
Domain Number 1 Region: 29-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000935
Family CBM4/9 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125974634|ref|YP_001038544.1|
Sequence length 254
Comment carbohydrate-binding, CenC-like protein [Clostridium thermocellum ATCC 27405]
Sequence
MLKKVAVCVASALLFSMLLCQWGFAAENLLKNPSFEEVDNNMPLGWSTWVWNYQNGVVEF
KVEQEGAQSGQYYVTIENREARDARYLQEVTVSPNSYYKLSGWIKTENVGNDVLGANLSL
EGVTTYSKDIRGTVDEWQYTELYIKTGENVETIKVSLGLGGYGNLNTGKASFDNVMLEKV
DNVPDGARCVIVENPDNTSSDSSEDDQKNSTGSTQGKYTWFWPIVSAIALATIQYYYSRP
KNVKSTKDSSDKKE
Download sequence
Identical sequences A3DHC2
gi|125974634|ref|YP_001038544.1| WP_003516878.1.16390 WP_003516878.1.19387 WP_003516878.1.20586 WP_003516878.1.31213 WP_003516878.1.55520 WP_003516878.1.6636 WP_003516878.1.6965 gi|385780072|ref|YP_005689237.1| 203119.Cthe_2148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]