SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975243|ref|YP_001039153.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975243|ref|YP_001039153.1|
Domain Number 1 Region: 28-460
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.09e-144
Family Cellulases catalytic domain 0.00000000173
Further Details:      
 
Domain Number 2 Region: 478-622
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.51e-35
Family Cellulose-binding domain family III 0.00018
Further Details:      
 
Domain Number 3 Region: 636-706
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.47e-20
Family Type I dockerin domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125975243|ref|YP_001039153.1|
Sequence length 707
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKIGILVLITALLAGIIPKSALAEEPKFNYVDAFAKSILFYEANWCGPDAGNNRIKWRG
PCHIEDGKDVGLDLTGGFHDCGDHVKFGLPQCASASTLAWAYHEFSDVFIEKGQDEYMLN
ILKHFCDYFMKCYPEKNKFYYQVGDGDVDHQYWGPPELQSYDRPTYYVATPENPGSDVAG
DTAAALALMYLNYKDRDLEYAEKCLAYAKDIYEFGMTYRGNSKGQSYYLPRDYLDELMWG
SLWLYVATGEQKYMDNLEKLMVEKRIGDEAGNSFNDNWTQCWDYVLTGVFIKLATLTDKP
LYKQIAEDHLDYWQNRIKSTPGGLKYLDSWGVCKYPAAESMVQLVYYKYTGDKRCLDFAK
SQIDYILGDNPKKMSYVVGFGDNYPKFPHHRAASGRLEGPPADETKNDPQRHILYGALVG
GADINDEYYDDIDKYVYSETGLDYNAGLVGALAGMSKYFGQGQMPEDTPGIEGEPPVYYA
DAKIYEENESGITVDLNMYNIVTSPPQYESDLSCRYFVDLSEYAGENIDMSKFVTKVYYS
PAGATISELKPYDKEKNIYYVEISFPNPVYARTYVQFCIYYYENKLWDSSNDFSYQGIGD
TYKTLENIPIYKNGVLVAGKEPSGAGPVEPTPPPKNYVYGDVNGDGKVNSTDCSIVKRYL
LKNIEDFPYEYGKEAGDVNGDGKVNSTDYSLLKRFVLRNIDKFPVEQ
Download sequence
Identical sequences A3DJ31 B0JFE6
gi|125975243|ref|YP_001039153.1| 203119.Cthe_2761 WP_020457911.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]