SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125975288|ref|YP_001039198.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125975288|ref|YP_001039198.1|
Domain Number 1 Region: 58-123
Classification Level Classification E-value
Superfamily E set domains 0.0000000616
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 2 Region: 135-207
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000145
Family beta-mannanase CBM 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125975288|ref|YP_001039198.1|
Sequence length 234
Comment hypothetical protein Cthe_2806 [Clostridium thermocellum ATCC 27405]
Sequence
MKKNKILAVVASCLLLISVFANTATPAFGEATGAPGKPILGIVEDNGVISCKIILLADNN
NGTRWRLYENGKLIQCGSAEDNTPEPQVIILEPFTRPAGQYKYKCELINKYGSTFSDERI
FTVNHGFIDEVPQAIFTEDFENGANGWTVVSSDPGSTVVIENGTGIYGSKCVKISSSVFS
DTAYTKQISGLTIGEKYRLTAYVKYQDVVRDPNSFYWPVIGPNVCIYPTWDLFR
Download sequence
Identical sequences A3DJ76
gi|125975288|ref|YP_001039198.1| 203119.Cthe_2806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]