SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|568263234|ref|YP_008966709.1| from Paenibacillus larvae subsp. larvae DSM 25430

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568263234|ref|YP_008966709.1|
Domain Number 1 Region: 14-48
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.000017
Family Anthrax protective antigen 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568263234|ref|YP_008966709.1|
Sequence length 51
Comment toxin-like protein [Paenibacillus larvae subsp. larvae DSM 25430]
Sequence
MTPKHTRQKREVEEVMDTDDDGIYDSWEREGYTVINRVVVKWDQEKHKPPE
Download sequence
Identical sequences V9W6R2
gi|568263234|ref|YP_008966709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]