SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116513500|ref|YP_812406.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116513500|ref|YP_812406.1|
Domain Number 1 Region: 8-423
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.45e-119
Family HD domain 0.000000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116513500|ref|YP_812406.1|
Sequence length 437
Comment HD superfamily phosphohydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MTKFDSPKLAREVVVRDPVHGYIHLDTQVALEVVRSQEFQRMRRIKQLGPTAFVFPGATH
TRFEHNLGVYELARRISNLFTDKYPSQSTGDGLWDPSENLLVQMAGLLHDIGHGPYSHTF
EHLFGTNHEQIGQQIILDPSTEVNQALSKVDPDFPKAVASVIAKTYPNPQVVKLISSQAD
ADRMDYLLRDAYFTGASYGEFDLSRILRVIRPYEKGVCFTANGMHAVEDYIVSRYQMYQQ
IYYHRVNRSMEVILHHLLKRAQYLYQEKELPVTPSLARFLAGTWDLQDYLKMDDGVMETN
FSMWTESSDPVLVDLTKRYLFRRPLASAKINEESKQLLPQLKDLIKKAGFDPDYYTGVGS
AFDEPYDAYKPSGKNANSQIEIMQEDGSLIELSQLSPLVKALNGTLQGDERFFFPVAMLK
QADFQQYLKNGELLTKK
Download sequence
Identical sequences A0A0U5KA19
321956.LBUL_0306 WP_011678010.1.11778 WP_011678010.1.31115 WP_011678010.1.43743 WP_011678010.1.46396 WP_011678010.1.69250 WP_011678010.1.75338 WP_011678010.1.87012 WP_011678010.1.96615 gi|116513500|ref|YP_812406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]