SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116513637|ref|YP_812543.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116513637|ref|YP_812543.1|
Domain Number 1 Region: 316-498
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.67e-36
Family Ppx associated domain 0.027
Further Details:      
 
Weak hits

Sequence:  gi|116513637|ref|YP_812543.1|
Domain Number - Region: 6-115
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.0011
Family Ppx/GppA phosphatase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116513637|ref|YP_812543.1|
Sequence length 503
Comment exopolyphosphatase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MSKRQFGLIYISSYQARLFIVDLKKLAIIEQLSSVQFVQGGKKFEVYENELPRLTDALIG
FKRKIAEYGIDNYKVYGNRQLLDKISARYLADQIKVRTGLEIEWLNGAQIAYYKIIAGMA
LPQFSELADDEFTYLLSMGSAMLNLTLFKGQHYLSTWNFALGPEEIEEMAAMTRDTPSDP
IDIIGDYISRKLVSFKTIEKPTGKARIIIQHVFGRGEQSLRPQEKARVIDLKQFAGVYSD
FREAPDQYLMEKYELDTDSLARMKPTIVLINQLVKIIKPHMMTLTQSSAITGLMIQEAAR
LKYRPDEYSTIVLTATKNIARRYESGGQHINLSNKFALHIFDRLAHAGMVDRRDRQLLEI
AARLHDIGNFINFHNHYEHAAYIVGANQIIGLSDRENEMLLSILKHQDITNLNADEREYR
HLDPALQVRVAKLAAILRLANSLDASRKQKISKIVVSIKDEKMLIVVTSKRDLTLERWVF
EKNVNLAEAVFGMKIAMKQKRGK
Download sequence
Identical sequences A0A0U5FRE7 F0K0F8
WP_003618769.1.15974 WP_003618769.1.31115 WP_003618769.1.33988 WP_003618769.1.43743 WP_003618769.1.46396 WP_003618769.1.75338 WP_003618769.1.87012 gi|116513637|ref|YP_812543.1| 394618 321956.LBUL_0463 gi|385815250|ref|YP_005851641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]