SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116513948|ref|YP_812854.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116513948|ref|YP_812854.1|
Domain Number 1 Region: 9-196
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-71
Family HD domain 0.000000625
Further Details:      
 
Domain Number 2 Region: 186-399
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 4.58e-66
Family RelA/SpoT domain 0.00000515
Further Details:      
 
Domain Number 3 Region: 382-454
Classification Level Classification E-value
Superfamily TGS-like 1.46e-22
Family G domain-linked domain 0.057
Further Details:      
 
Domain Number 4 Region: 683-751
Classification Level Classification E-value
Superfamily ACT-like 0.000000242
Family SP0238-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116513948|ref|YP_812854.1|
Sequence length 754
Comment guanosine polyphosphate pyrophosphohydrolase/synthetase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MSKYTEMTHEQVMAACNKYMTANQLAFVESAYQFAARAHEGQTRASGQPYIVHPTQVAGT
LANLGLDPDTVAAGFLHDTVEDTSVTNDDIKEKFGADVAFIVDGVTKLNKYEYKSHKEFL
AENHRKMLIAMAKDLRVILVKLADRLHNMHTLEHLLRPDKQRRIAAETLDIYAPLADRLG
IGTIKWKLEDMSFHYMNPEAYYKIVSMMDAKRSEREGYIKDAIDYLRGTLDSLGIKYDIS
GRPKHIYSIYKKMVNKHKNFNEIYDLLAVRVIVPTVKDCYAVLGAVHTKWKPMPGRFKDY
IAMPKANGYQSLHTTIIGPGGKPLEIQIRTEEMHKVAEYGVAAHWAYKRGNFQGVDEKEG
GALDIGREILELQKDSSDADEFMEAVHSDIFADKVYVFTPKGEVYELPKGSVTLDFAYAI
HTQVGDHAIGAKVNDKLVPLDYKLKNGDVVDILTQSNARPSRDWAEMVKTSRAKNKIRRY
FRDVDREESLARGKSELVDLLKENGLSAKDFLDKSHIDEVLDHFSFKTDEDMYAAIGFGN
MSAVSIYNRLTADLRRQQEEEKQKQFEAQIMSAGQQAAASSVVKKPAPQKDDAKSKTKGK
KPDSLVRVQGLEDLDMHFAKCCNPVPGDLIVGYVTKGRGVTVHRVDCRNVVSADPAAQGR
MIDVEWNNIDEGKQASFNANFELFGYNRQKLLGDVINRLNALTKNITNVSASVNEENIAH
FYITVEVRNAAQLNDIMAKLRDIPDVYDTKRTDN
Download sequence
Identical sequences gi|116513948|ref|YP_812854.1| WP_011678186.1.43743 WP_011678186.1.75338 WP_011678186.1.87012 321956.LBUL_0810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]