SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116514231|ref|YP_813137.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116514231|ref|YP_813137.1|
Domain Number 1 Region: 337-489
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-16
Family HD domain 0.022
Further Details:      
 
Weak hits

Sequence:  gi|116514231|ref|YP_813137.1|
Domain Number - Region: 452-613
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00144
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116514231|ref|YP_813137.1|
Sequence length 688
Comment glycyl-tRNA synthetase subunit beta [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MTKDFLFEIGVEEMPAHVVSKSVKQLADRTGKFLKENGLGFKEIKTYSTPRRLTVLVKEL
DEKQADVDEVKKGPAKKIAQDADGNWTKAAVGFARGQGMSADDIYFEELKGVEYAYVHVQ
KAGKEAKEILLGLDEVIKAMTFPTKMRWDSQDFEFVRPIHWLVALYGSEVVPVEFLDITA
GRKTAGHRFLGDSVVLANADDYVEALRDQYVIVDADERKAMIVSQINDLVNSHNWQIKLD
ASLLEEVNNLVEYPTVFAGSFDQKYLEIPDEVLITSMKDNQRYFEVYDQEGKLINCFISV
RNGNKDHLENVISGNEKVLVARLDDAVFFYDEDRKYPISHFVDRMDSVSFHDKIGSMAEK
MTRVRIIGDYLAKRFGLSAEEVADFDRVSGLYKFDLVTQMVGEFAELQGVMGMHYACLAG
ENENVSVAIKEHYMPTTAEGDLPKTKVGALLSVADKLDTIIAFFGAGMIPSSSNDPYALR
RYAYGIVRILLNEDWSLPFDQVVPEIVELLSGKTPAKLPQGAEEDKQLADFIRDRIKQFL
QKNNYQYDVIDAVLASSEQDPSQILAAAKVLQQHHDDEAFKPVVESLTRIANILKKAKFS
QASPVDPSLFEDRSEQDLYDGVEALANVKDHAELYEAFVALQGVIDRYFDVNMIMAKDEA
VKNNRLSQLAAVNDLAKRLGDLSKLVIK
Download sequence
Identical sequences Q04A23
321956.LBUL_1166 WP_011678360.1.43743 WP_011678360.1.75338 WP_011678360.1.87012 gi|116514231|ref|YP_813137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]