SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116514438|ref|YP_813344.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116514438|ref|YP_813344.1|
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.49e-30
Family HD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116514438|ref|YP_813344.1|
Sequence length 185
Comment HD superfamily NAD metabolism hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MSSSELVAKEKSMMDENRFAHCVRVSETARTLAKLNGYDEDKAALAGFVHDYAKQIPVEE
YIKVIKEEGFDPDLLNWNRAIWHGSVGSWFIKRDLGITDPEILTAVYRHTTGDVEMTTMD
QIVFVADYIEPGRTFAGVEEARKTSYADLASGVGYELAHTLAFLVQKRSKIYPRTLAAYN
VWAAE
Download sequence
Identical sequences gi|116514438|ref|YP_813344.1| 321956.LBUL_1393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]