SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116514468|ref|YP_813374.1| from Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116514468|ref|YP_813374.1|
Domain Number 1 Region: 147-281
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000138
Family MioX-like 0.057
Further Details:      
 
Weak hits

Sequence:  gi|116514468|ref|YP_813374.1|
Domain Number - Region: 17-85
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000925
Family Single strand DNA-binding domain, SSB 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116514468|ref|YP_813374.1|
Sequence length 301
Comment HD-superfamily hydrolase [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365]
Sequence
MLKRLLDYNEGEEFDLVLMVKNSELRQDKRGKHYLLMQLADSSGSIRANYWQAKAEDASR
FNAGTVVEASGMIEDYHNHDQIKLFSIHPVSPDDQADLSQLVATAPEKPAEMEKEIKDFV
AQIDNKNWHDLVDFLLKKWSSRFFAYPAGKSNHHAYKGGLAFHTLTMLKDARGLADNYPA
VNRSLLYAGCILHDMGKVLELSGPVATQYTAEGNLVGHLVLIDEQLMLAAQELKIDLASE
DLLLLRHMVLSHHGRYEYGSPKLPALLEAELLHRIDDLDAAVNAITTVNCPRPSRGNSPR
R
Download sequence
Identical sequences gi|116514468|ref|YP_813374.1| 379450 321956.LBUL_1427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]