SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153002906|ref|YP_001377231.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153002906|ref|YP_001377231.1|
Domain Number 1 Region: 599-768
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-41
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 787-907
Classification Level Classification E-value
Superfamily CheY-like 1.08e-37
Family CheY-related 0.0042
Further Details:      
 
Domain Number 3 Region: 304-426
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-20
Family Heme-binding PAS domain 0.081
Further Details:      
 
Domain Number 4 Region: 167-304
Classification Level Classification E-value
Superfamily GAF domain-like 1.46e-17
Family GAF domain 0.0041
Further Details:      
 
Domain Number 5 Region: 425-569
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000209
Family BphP N-terminal domain-like 0.096
Further Details:      
 
Domain Number 6 Region: 15-118
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000209
Family Heme-binding PAS domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153002906|ref|YP_001377231.1|
Sequence length 917
Comment multi-sensor hybrid histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MEPGPVPTATDTDPLLDILFAHAGIGLCLVAPDGRVVRANGDWLRAMGLSSQAVGEDVLA
LLGEDGGLTSLLERARRGEPVELPSRRRIDQHGRSTCWEGRLVPVPTRLGAGVLLTAREV
PGALARERGSEPERSRSGATPTAERLARERAELLASMAQDLSGGADLDAVLRAAVERGTE
LLGGVDGAFLLLEPDGRHARVHSEAWKLGRTGTVLDVDAIPAGRAALAERRPRFVSGGHG
QGEGLAWLKSRGARSWLIAPVSVQGQRLGLLYVARAEGDRPPQPDLDFAEAIANHAALAI
TRARGSQALRRSEERFRTLAEHAPDVITRFDRDMRLLYANAALGRVTGIPAAHVTGKTSA
ELELPADLVACLEAGLARVFETGEPRTLEFRFDGPHGTGYHEARLAPEPGEDEGVASVLA
VTRDITERKHAEHSLREAEERARARADELEAVLDAVPAAVCITRERDARHVEANNLCREL
LRLPPAVNLSRTVPGDGAPSFRAMKDGVEIPAHELPLQVAAARGVEVRNHEFSLVFADGT
RRHVLGNAAPLRDELGDPRGAVVALVDITERRRDEDALGASRASRARAEAGRGGARLVDD
LLDVTRISRGKIQLRRTLVDLAGIVRRTVDDHAALFAQQELGLRVSGADRPLWVDGDRTR
LAQIVGNVLVNAAKFTGAGGRVEVEVAAEDDARARVTVRDTGVGIAPRLLGRVFEPFIQA
EDSLHRSRGGLGLGLALVKGLVELHGGTVEARSEGIARGAEFTLRFPRCADAPSGSVRDE
EPAAAARPRRVLIVEDNLDAAETLCLMLEMCGHEVGVAHDGHGAMEQVRAFRPDVVLCDI
GLPGMDGYEVARAIRSDLALADLPLVALTGYALPDDQRRAIEAGFDRHLAKPVSSDELQR
VIGALSARAPGLTPARA
Download sequence
Identical sequences A7H6A1
404589.Anae109_0027 gi|153002906|ref|YP_001377231.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]