SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153002965|ref|YP_001377290.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153002965|ref|YP_001377290.1|
Domain Number 1 Region: 166-403
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.75e-68
Family Extended AAA-ATPase domain 0.00000339
Further Details:      
 
Domain Number 2 Region: 14-121
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-19
Family Heme-binding PAS domain 0.057
Further Details:      
 
Domain Number 3 Region: 416-456
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000243
Family FIS-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153002965|ref|YP_001377290.1|
Sequence length 470
Comment sigma-54 dependent trancsriptional regulator [Anaeromyxobacter sp. Fw109-5]
Sequence
MIPSLPYLGLGSAESLQQVADAFPDGVFTTDRDGVITYWNPAAGAITGYSAAEAIGRTCA
LLAGDMGRGCMCGGGPVRCGISDRGKSSKCCSIRTKDGRERLIVKNAVAFHGPDGTVAGA
LESFTDVTDLSVGAIPWESACALPAPSAGVAAAAEAAPPESECAGLLGCHPVMRELYRMI
ALVARSDATVMILGESGVGKERVAEAIHRQSRRAAGPLVRVSCSALNENLLESELFGHVK
GAFTGALRDRRGRFQEAHGGTLLLDEIGDISPAVQVKLLRVIEQRVVERVGDSQPLPVDV
RLLCATHRDLKQLVTDGRFRADLYFRLAVFPLRVPPLRERAEDVALLSEGFLARLGAPPP
SPEASRLLAAYAWPGNVRELQNVLEYAALQAGGAPISPAHLPAEIRGAAPPTPERAAPDR
SAIVEALIRTGWNRARAADVLGISRVTLWKRMKRLGVVGPGPMASGREPL
Download sequence
Identical sequences A7H6G0
404589.Anae109_0086 gi|153002965|ref|YP_001377290.1| WP_011984412.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]