SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003115|ref|YP_001377440.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003115|ref|YP_001377440.1|
Domain Number 1 Region: 801-1027
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.96e-52
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000801
Further Details:      
 
Domain Number 2 Region: 291-490
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.85e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000399
Further Details:      
 
Domain Number 3 Region: 40-135
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.62e-19
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0033
Further Details:      
 
Domain Number 4 Region: 138-183,269-323
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.96e-17
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0099
Further Details:      
 
Domain Number 5 Region: 185-267
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.26e-16
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0051
Further Details:      
 
Domain Number 6 Region: 564-660
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000000000523
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0091
Further Details:      
 
Domain Number 7 Region: 711-803
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000183
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153003115|ref|YP_001377440.1|
Sequence length 1067
Comment acriflavin resistance protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MLISDFAIKKPIVTVTVMLALVIFGLIALVALKTDEFPDVQPPVVAVTIVYPGASPETVE
RELIDPIEDAIFSISGIDGEQTTASATDGLAQFIVFFDFEKDLQEATQDIRDAISEKRAD
LPLEMEEPIITRFDPADEPIVSLTLTSGSIDVPSLTRLADEVVSRELRAVQGVADVRLVG
GRKRELTVELNPQAMAAAGVSASDVVGALQAQNLAAPVGRVNTPLGEQSIRLSGRLQTPD
EFAAIAVATRGGQVVRLGQLGSVKDGAEEPRTLALYDTSEAVGLEVLKTKGYSTTAVADE
IKARAKALEPRLPKAAKLQVVQDAGERVRRSVNEVQTTLVEGALLTVLVVFFFLNSWRST
VITGLALPVSVLAAFISVWMFGFTLNTMSLLGLSLAIGILIDDAIVVRENIVRHIELGED
HTTASFKGTDEIGLAVAATTFSIVSVFVPVAFMYGVAGQWFKPFALTIAAAVLVSLFVSF
SLDPMMSAYWPDPQIEKGQARGPVGRALGAFNAWFDRQADRYKGVVAWALDHRWTMIALA
GLSFFGAIFLQGAFGGAGFVPISDRSEVNLIVQTPPGSSLDYTRAKVEEANAIVRSHPEV
KYVYSSIGTPIPLQAPGVDQALVYVRLVPKADRARSQEELGTTLRRELKRVAGAEISVFT
SGFGGAFKSIQLELRGPDSRVLAQYAEKVKAVAQAVPGAVDVGLSTRGQKPELEVAVNRG
LAGNLGVTVGQVAQSLRIAFAGLDSGDWVDPTGETRDVMVRLAPEARERAVDLRQLPLVL
HPQNGGNPQVVPLGQVATVREGLGPAQIAHLDRERVINIQGNVAGRSLTEVVQDIERRLG
AEVKLPPGYTIRQGGESRDQQEVFMRVGLALLLAVLLMYLILVLQFGSFLDPLAILLSLP
LSLIGVVGALLLTGDTLNIMSLIGVILLFGIVAKNAILLIDFAKWAREERGISIRDALVE
AGRIRLRPIMMTSVAIIAGMIPVALGAGEGGDFRAPLGRAVIGGVITSTLLTLLVIPTVY
EIMDSFRERALRGFRRLLGGGRGGGNGTSEPAPAPHARAGGVRRELE
Download sequence
Identical sequences A7H6W0
WP_011984562.1.20576 gi|153003115|ref|YP_001377440.1| 404589.Anae109_0238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]