SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003379|ref|YP_001377704.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003379|ref|YP_001377704.1|
Domain Number 1 Region: 157-390
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.11e-52
Family Extended AAA-ATPase domain 0.000026
Further Details:      
 
Domain Number 2 Region: 20-126
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-20
Family Heme-binding PAS domain 0.029
Further Details:      
 
Domain Number 3 Region: 408-446
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000281
Family FIS-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153003379|ref|YP_001377704.1|
Sequence length 453
Comment sigma-54 dependent trancsriptional regulator [Anaeromyxobacter sp. Fw109-5]
Sequence
MPRLPEHSPSLFPDVDTVESLRRVADALPEGVFVTDRDGKVTFWNRGAERITGWSRDEAI
GQRCSLLAGDYVNGCTCGAGPLYCGIAERSRTARRCTLRTRDGRPQVIVKNAIALYAADG
TPVGTLETFTDVDPGPELACALGGAVAATAPGDLCGLVGRHPAMVELYRMIRLVARSSAT
VMITGESGTGKDRIAEAIHSLGERAAGPLIRYSCAALDPGAAEGELFGTSDGRRGRIASA
ERGTLLLDEVSGAPPALQTKLLRLVEDRTFTARDAAPIPADVRILCTTQRDLRHLVQEGR
FRADLYFRLAAFPLHVPALRERIDDVPLLAERFLAEQRAAGHAVGTLSPQTLRVLRAYPW
PGNVRELRNTIEYAALVAGAGEIAPEHLPRDVLESRAAPGTPCDPDVDARRALVEALERT
GWNRTRAAELLGVSRVTLWKRMRRLGVADPGER
Download sequence
Identical sequences A7H7M4
404589.Anae109_0506 gi|153003379|ref|YP_001377704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]