SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003402|ref|YP_001377727.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003402|ref|YP_001377727.1|
Domain Number 1 Region: 346-518
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-44
Family Histidine kinase 0.0011
Further Details:      
 
Domain Number 2 Region: 533-654
Classification Level Classification E-value
Superfamily CheY-like 1.08e-30
Family CheY-related 0.0056
Further Details:      
 
Domain Number 3 Region: 39-152
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.16e-25
Family Flavin-binding PAS domain 0.019
Further Details:      
 
Domain Number 4 Region: 147-276
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000297
Family BphP N-terminal domain-like 0.064
Further Details:      
 
Domain Number 5 Region: 283-358
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000334
Family Homodimeric domain of signal transducing histidine kinase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153003402|ref|YP_001377727.1|
Sequence length 659
Comment PAS/PAC sensor hybrid histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MQRRVPLESPAGVTEGDLGERGEGCRDGAVGEDREFRAIFELAGSGKAIADPARRRLVRV
NRRFCEITGYTAEELLDREVTEITHPADRARDAAAVEAALRGETDGWNIEKRYVRKDGLI
AWVVVTGNVLRDAAGAPVRTVATVHDITARKRIEEDLRASEALLRLAQRAAHAGVWELDL
VAGTAWMSRECHALYGTALAARGPDIASWRRRVVPEDAPAVAAALTAAVERAEEYSAEFR
IHHPALGERWIWEIGGAEYDASGAPVRVRGIALDVTERKHGEQALLAADRRKDHFLAVLS
HELRNPLAPMWNALGVLERPDASEDTSRRAQAVLQRQLAHLSRLVDDLLDLTRISRGKIQ
LRPAPLGLTEVVRRAAEDHRPLFAEAGVALDVRLPDAPVPVSGDATRLTQIVGNLLLNAV
KFTPRGGHVLLELTPGEKDALLRVRDTGVGMDGEMLARLFEPFAQAEVSLERSRGGLGLG
LALVRSLAELHGGHVWAHSDGPGAGAEFLVRLPIARVEAAAPPVPTSAGAFARRRILVVD
DNVDAAETLRDLLVLDGHEVAVAHDGEAAVERIGALRPEIVFCDIGLPKLDGYGVARACR
DDPGTRGAYLVALTGYALPDDLRRATEAGFDEHLAKPPPLAAIEAAVRRAASRTERSSS
Download sequence
Identical sequences A7H7P7
WP_011984849.1.20576 404589.Anae109_0529 gi|153003402|ref|YP_001377727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]