SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003412|ref|YP_001377737.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003412|ref|YP_001377737.1|
Domain Number 1 Region: 510-679
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.22e-44
Family Histidine kinase 0.00071
Further Details:      
 
Domain Number 2 Region: 700-815
Classification Level Classification E-value
Superfamily CheY-like 6.26e-34
Family CheY-related 0.0035
Further Details:      
 
Domain Number 3 Region: 111-250
Classification Level Classification E-value
Superfamily CheY-like 2.7e-33
Family CheY-related 0.013
Further Details:      
 
Domain Number 4 Region: 438-522
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.1e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 
Domain Number 5 Region: 285-442
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000000894
Family GAF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153003412|ref|YP_001377737.1|
Sequence length 816
Comment multi-sensor hybrid histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MDRWWDLKRSAAPRRPGTTLSPVGALLYGKFPIYLTPVRGPPRERARARPHPDIPNAMES
SHPSPAPRPEGERAGPEARGGERNAAAPRDERPAPSRPEGERAVSIGEAQPVDVLAVDDD
PRNLEATRALLSGSGARIVEARSAEEALRILLTREVALILLDVGLPGMSGLEMAKLVRAR
ERTRHTPIIILTASSDPRLLERGYALGAVDFLTTPVPEQALRAKVAFFIEAHRKNEALRH
NAELLRAAQERELARNVAEARRRWEEEALRREMERDRRLVDTLHRANERLKLLSSVRSDL
LTAQVVRERLPAICDRVAAHLGLERWSLHLADPDGRLSLAATGGADGAQVARARALDSVE
AILGGTAARVAARGEPVPPIGEALGVVCCAARPLHTGDRVLAAFAFGSAERDACDPDDPA
TLELVGYAMAMALERDRLIAELQGRNAELREADRRKDQFLAMLAHELRNPLAPVTNAVRL
LQDYGADAHVRERALAAAERQVRHMARLVDDLLEVSRVRSGKVCLRKETVELARVVREAV
QSVDELVASRGHALALELPDAPLLVEGDAVRLTQVVENLLTNAVKYTDPGGHLRVELRRE
GREAVLAVRDDGIGIAPELQDTIFELFVQAEQGVDRSRGGLGIGLSLVKTLVDMHGGAVG
VTSAGPGQGSTFTVRLPALAEDTAVPAAPEPARPARGRRPRDILVIEDNPDIRETLAELL
RRRGHAVREAEGGRAALELARDLAPEVALVDIGLPELDGFEVAQRLREVAPEVRLVALTG
YGRAEDRRRGAAAGFLAHLVKPVDIDELSAVIDSLD
Download sequence
Identical sequences A7H7Q7
gi|153003412|ref|YP_001377737.1| 404589.Anae109_0539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]