SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003492|ref|YP_001377817.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003492|ref|YP_001377817.1|
Domain Number 1 Region: 347-506
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-42
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 2 Region: 271-354
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000235
Family Homodimeric domain of signal transducing histidine kinase 0.0034
Further Details:      
 
Domain Number 3 Region: 225-273
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000262
Family HAMP domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153003492|ref|YP_001377817.1|
Sequence length 518
Comment integral membrane sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MRRVATRIFLTFAVALAAFGAVAVFAIVRLHDARRDLRLLSSGYLPLTRIAAQLETKDWV
AARALEARALDRSARQAYLPVARAHFPALVREKIEEAKRVVADARLLAREDDARFLQDVE
GRLQALGARWSEYDGKARALFDALEAGEGQDPSTAAAFEARAQEVRQLEKGLSLDVKLLQ
VALESQIADRVRAAERSEGRTVALIVIYSLIALGIGVGAALLSQRLLAPIQTLTEGVKAV
AAGDLSRQVAVRSGDEIGLLAREFNAMAASLDRQQDELRRAERLAAVGRISAQITHEIRN
PLNAIGLNAELLAEELAELDVPPREALQLVSAISREVDRLNGVAEEYLRFARLPKPALAR
QDLNEILSGLLDFLGPELAAARIELERALAAGLPAVQADEGQLRAVFLNLLRNSREAMPS
GGTVTVRTRRVGDAIEAEVSDTGGGIPPGDLTRIFEAFYSTKERGTGLGLAFTRQVVVEH
GGSIRCDSTVGQGTTFVVRLPAAADEPMEGPVEAASTR
Download sequence
Identical sequences A7H7Y7
gi|153003492|ref|YP_001377817.1| 404589.Anae109_0620 WP_011984939.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]