SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003519|ref|YP_001377844.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003519|ref|YP_001377844.1|
Domain Number 1 Region: 232-414
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.05e-34
Family Histidine kinase 0.0000165
Further Details:      
 
Domain Number 2 Region: 11-129
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.62e-29
Family Chemotaxis protein CheA P1 domain 0.0023
Further Details:      
 
Domain Number 3 Region: 415-545
Classification Level Classification E-value
Superfamily CheW-like 2.49e-28
Family CheW-like 0.00045
Further Details:      
 
Domain Number 4 Region: 168-231
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000902
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153003519|ref|YP_001377844.1|
Sequence length 558
Comment signal transduction histidine kinase CheA [Anaeromyxobacter sp. Fw109-5]
Sequence
MDELGIDRELLVQTFLAEAEETFGRMEQALVALEARPGDEEILHALFRDAHTLKGGAALV
GFDGVRDLAHDLEDVLERLRVRSLGVTDALVTLLLRSVDVLRQAVGAAAAGAEGESPAAL
AFRRRLADAAQAAGAPSGAGPDAPLPARGGGGGAPERAAAPGHGSGARTLRVDVAKLDRM
LDLAGEIAVARGRLTDLLEQRGGDGAEHLLEAHREADRLYQDLQELIMQARMVPIGPTFH
PHARTVRDAASALGKRARLVVEGEDVEVDTAVIEHIRDPLTHMVRNALHHGIESPEARRA
RGKPPVGTVVLRAFHEAGSMVIQVADDGGGLDRARIAARAVAQGLALEADRVTDEEAARL
VFEHGFSTADRVTELSGRGVGMDVVRRNVEALRGSVAIHSAPGVGTEITLRVPLTLAIIQ
GFKVGVADETFILPLDAVVECLELPAEQSAAGAPCGILNVRGAPLPYLRLRDHFGLGGAP
PARQNVVVVRHGAHTAGVAVDALHGESSTVIKPLGRMFGGVVGISGSSILGNGNVALILD
VGGLLRETLRRAAQAQAA
Download sequence
Identical sequences A7H814
404589.Anae109_0647 gi|153003519|ref|YP_001377844.1| WP_011984966.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]