SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003522|ref|YP_001377847.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003522|ref|YP_001377847.1|
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily CheY-like 4.7e-40
Family CheY-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153003522|ref|YP_001377847.1|
Sequence length 123
Comment response regulator receiver protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MDRKKILLVDDSSTVLLMERMILSKYAYDVVTAKDGAEGVEKAIAERPDLILMDVVMPRM
DGFEACRRIREQEDTREIPVIMVTTRGELASVESGYASGCNDYVTKPINGLELLAKVRSC
LGQ
Download sequence
Identical sequences A7H817
404589.Anae109_0650 gi|153003522|ref|YP_001377847.1| WP_011984969.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]