SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003663|ref|YP_001377988.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003663|ref|YP_001377988.1|
Domain Number 1 Region: 426-588
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.45e-44
Family Histidine kinase 0.00061
Further Details:      
 
Domain Number 2 Region: 354-437
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000726
Family Homodimeric domain of signal transducing histidine kinase 0.0039
Further Details:      
 
Domain Number 3 Region: 34-192
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000131
Family GAF domain 0.013
Further Details:      
 
Domain Number 4 Region: 206-363
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000113
Family GAF domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153003663|ref|YP_001377988.1|
Sequence length 592
Comment GAF sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MDSRDESTAASHAGGTDPCWEAERAARREAEASAARLARLQAVTAALSSARTPDEVAEVT
LGRGVWALGGARGLLLVPGAGGGMDVLPSPGAADAFASAAARLPGPGPVRDAFHHGAPVF
LPDRAAIAARYPGLDGLAGAALVALPLPSQGLPLGVLLVGYDAPRAFPEPDRALAFSLAF
HCAQALDRARLFVAERLARAEAVAAQRRLAFLDEVSAHLAATLEEDEMLAGLVRLAVPAL
GDWAGVLALGDEGLEVAARLGPDAVGAPVEALVRGLALERLLAAGDAARAETVEEFSAPG
DAAGGPAPRAAVLAPLVAAGGVIGVLAVASADPARRYGAGDRVLVADVARRTALAVAHVR
LLRDARVAARAREEFLQVASHELRGPLGTLRLGVQLLLREGGSKPPEARLRMIERQADRL
VRLADTLLDVSRITAGRFALAREDGDLAALVRDVVARYAEEASDARCALTCEAPGPLRGS
YDASRLEQVLSNLVSNALKYGRGRPVRVALSSADGVARLSVADRGIGIAPADQARIFGRF
ERAVSGRHYSGLGLGLWIVRQIVAAHGGRIGVESTLGEGATFTVDLPLSPSA
Download sequence
Identical sequences A7H8F8
404589.Anae109_0792 WP_011985110.1.20576 gi|153003663|ref|YP_001377988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]