SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003672|ref|YP_001377997.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003672|ref|YP_001377997.1|
Domain Number 1 Region: 144-332
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000000000196
Family PP2C-like 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|153003672|ref|YP_001377997.1|
Domain Number - Region: 29-130
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00019
Family Histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153003672|ref|YP_001377997.1|
Sequence length 335
Comment putative anti-sigma regulatory factor [Anaeromyxobacter sp. Fw109-5]
Sequence
MALTHGESLVVPVGEESQVGEARRSARRMASDLGLGEVAAERAAIVASEAARNIVTHGGG
GLVAIHPIGHPPSGIAIIGLDRGRGIGDVATAMRDGHSTAGTPGEGLGAMSRVGSAFDLW
SAPGKGTALVAEVWAAGQRPPRRLAAGALSVAKPGEQVCGDGWALVELEDRAVLAVADGL
GHGRAAADAARVAIEVVRRTADLAPRDIVDAAHAALRATRGAALAVAALDLATGELRYAG
LGNVVGAIVGGGASRRLVSLAGTVGHAVRSIQEFSYSLPEGAVLVMHSDGIATHWDVAAY
PGLAARHPALLAGVLFRDHARGRDDATVLAARRAR
Download sequence
Identical sequences A7H8G7
gi|153003672|ref|YP_001377997.1| WP_011985119.1.20576 404589.Anae109_0802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]