SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003826|ref|YP_001378151.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|153003826|ref|YP_001378151.1|
Domain Number - Region: 42-138
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000482
Family DNA gyrase/MutL, N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153003826|ref|YP_001378151.1|
Sequence length 174
Comment putative anti-sigma regulatory factor [Anaeromyxobacter sp. Fw109-5]
Sequence
MPDRKPEPRQPIYLMLRMKPPWVFIDEIRRFVESFCACACDVAANRESQLALAVHELMQN
AVPHSHDEEVDLVLEVDPDADRVEVAVTNRCTEAEFRALEERIARMNREPDALRHYLTEM
STSPATVRGGLGLARVRFESQLELSLSRSGGRVTVHASGALRAPALKVPGGAHA
Download sequence
Identical sequences A7H8X1
404589.Anae109_0958 WP_011985273.1.20576 gi|153003826|ref|YP_001378151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]