SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003903|ref|YP_001378228.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003903|ref|YP_001378228.1|
Domain Number 1 Region: 53-204
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000253
Family Histidine kinase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153003903|ref|YP_001378228.1|
Sequence length 217
Comment hypothetical protein Anae109_1035 [Anaeromyxobacter sp. Fw109-5]
Sequence
MPEVQRAGPSSSAERENVSIETTTDVEQEFVGSRGEARGLGRPGAPAPGIDGEFPLDWSS
TTLAELCPAAIEEVGASEDGAIEYTPDQGREGSGEWDARRVAYAVTILLEDAVKRSGGAG
PVSLRWREYEDEVVLRVQFPRPLERGDRFVTYFEEGVRPDGADDKVGTLRLVVARKIVLQ
HGGHLARVRTRAGTAYVATLPRTRAAAGRAEPGLELE
Download sequence
Identical sequences A7H948
WP_011985350.1.20576 404589.Anae109_1035 gi|153003903|ref|YP_001378228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]