SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004191|ref|YP_001378516.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004191|ref|YP_001378516.1|
Domain Number 1 Region: 202-380
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.49e-41
Family Multidrug efflux transporter AcrB transmembrane domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153004191|ref|YP_001378516.1|
Sequence length 400
Comment protein-export membrane protein SecF [Anaeromyxobacter sp. Fw109-5]
Sequence
MRFKSFDIVPHGTKFDFVGKRHIAVVLSLIVNAAVLLWAVPAIHGLNFGVDFAGGTEMEV
KFAQPVDAGAIRKSVEDLGFKGASVQTYGDEEEHAFLIRVERIALMGEEDVKRVVDAVQA
KFPVERWSFNPEIGDKIDFEFKQPPSPQALQAAVEGAGVGVREVRAEQGLAAGTRSFAVI
TQGIREKIERDLSTHFAQAQPEVRRVEYVGPAVGRELRNQGFKAVLYAMALIVVYVGLRF
DFRFSPGVIIAILHDAIVTLGYFAFTGREFNLTSIAVLLTVVGYSVNDTVVVYDRIRENQ
AKYKGKSLAEIVNLSINETLGRTFLTSFATALSLVGLLVYGVGTLFDFSAAMLVGIVSGT
YSTWFIAAPMTIWFEERAAKKKASTPAAAAPSAPGRAAQK
Download sequence
Identical sequences A7H9Y6
WP_011985638.1.20576 404589.Anae109_1324 gi|153004191|ref|YP_001378516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]