SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004334|ref|YP_001378659.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004334|ref|YP_001378659.1|
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.99e-29
Family TM1287-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153004334|ref|YP_001378659.1|
Sequence length 190
Comment cupin [Anaeromyxobacter sp. Fw109-5]
Sequence
MSEAKVPGYSSDERAPLPPPRDLLIRAEDRVRLQEESARHPWNPRSEIHGYMLGRRAGLA
RVGVNLLRVPPGKESFAFHRHLREEEFAFVLSGKGVVDVGDETFEIGPGDFLGFPAGSHP
HNLRNTGREDLVYLSGGENRNAEIAEFPRDGKVMVRVGRDVTVYPRAAGEPFWPRHGGAE
GSDDVGPHEG
Download sequence
Identical sequences A7HAC9
WP_011985781.1.20576 gi|153004334|ref|YP_001378659.1| 404589.Anae109_1468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]