SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004463|ref|YP_001378788.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004463|ref|YP_001378788.1|
Domain Number 1 Region: 293-343
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000806
Family AraC type transcriptional activator 0.016
Further Details:      
 
Domain Number 2 Region: 240-290
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000206
Family AraC type transcriptional activator 0.056
Further Details:      
 
Domain Number 3 Region: 65-117
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0000426
Family Hypothetical protein TM1112 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153004463|ref|YP_001378788.1|
Sequence length 356
Comment helix-turn-helix domain-containing protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MPAPASTHTPLPGLTAGAPSEASLRADPLSDVLQSVRLSGAVFFHIEGSSPWVAEAPPSR
AVAGIFMPRAQHVIEYHAVTRGGCWGGIVGERPARLDAGDVIVFPQGDAHVLSSEPGLRA
PPDLATYASLLDGPPPVHIPLGGGGADRAEILCGFLGCDARPFNPLLATLPRVLHARLAD
ARGSALETFMEAALRETRERRPGGESVLARLSELMFVEVVRSYLAALPAGNTGWLAGLRD
EFVGRALALLHGRPAHPWTLDELARKVALSRSALAERFTQLVGRPPMQYLAGWRMQLAAG
LLLGDSAGVSQVAAEVGYASDAAFSRAFKKAVGVPPAAWRRSRSAKPVPGAAATTG
Download sequence
Identical sequences A7HAQ8
404589.Anae109_1600 gi|153004463|ref|YP_001378788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]