SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004500|ref|YP_001378825.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004500|ref|YP_001378825.1|
Domain Number 1 Region: 28-113
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00000000000139
Family Gentisate 1,2-dioxygenase-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153004500|ref|YP_001378825.1|
Sequence length 137
Comment cupin [Anaeromyxobacter sp. Fw109-5]
Sequence
MAHISIKRFSSPDETRPFADKGHAEILRFGEGTVGRGVFEPGWRWSTHVKPIAGTRSCQA
AHSGYVVSGRMHLVMDDGEEAEMAAGDYVTIPPGHDAWTVGDEACVIIDVAGMEHYAEGR
TASRAQQGTEAQPPAHH
Download sequence
Identical sequences A7HAU5
WP_011985947.1.20576 gi|153004500|ref|YP_001378825.1| 404589.Anae109_1637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]