SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004532|ref|YP_001378857.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004532|ref|YP_001378857.1|
Domain Number 1 Region: 299-397
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000395
Family Heme-binding PAS domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153004532|ref|YP_001378857.1|
Sequence length 540
Comment hemerythrin HHE cation binding domain-containing protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MALARTLLSGRRMSELIETGAPPRKDLLKHLILQLHGGVAPDAVQRQLVRLLGQVPYGLV
VEVEQELLADGMPAAEVTRLCHLHSAALQGAIDLSGVRTPPAGHPARVFSEENAALAKQV
QALEHAADALDAVVSEGGAGVHLLQARVRVNALTDVEKHYLRKEHLLFPFLERHGITGPP
QVMWGKHDQTRALLRAAHAALASAAGDPAAARALSDGALRPLASAIRDMVDKEENILLPM
ALDVLDEREWWEIARQSDEIGYCLVEPEASWRPDSVDATEAAAPAARVKLPTGSLAPAEL
EAILGALPLDATFVDAEDRVRWFSHGKERVFSRSRAVIGRKVQFCHPPSSVGTVETILAG
FRAGTQDRASFWIQLRGRFVHIEYRALRDVSGAYLGCLEVTQDLTEKRALAGEQRLLSWE
ATAQQASAPVQACPAHPGAPSAAAPHPARAESAAARPAWLEGARVSRSLDARPLLAAGAH
PVQEVMQELATLAPGAVFELVAPFVPGPLLERARAAGCLAHSEQEAPGLVRTWFTRGGAA
Download sequence
Identical sequences A7HAX7
404589.Anae109_1669 gi|153004532|ref|YP_001378857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]