SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004555|ref|YP_001378880.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004555|ref|YP_001378880.1|
Domain Number 1 Region: 846-1080
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.44e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.00022
Further Details:      
 
Domain Number 2 Region: 303-504
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.12e-34
Family Multidrug efflux transporter AcrB transmembrane domain 0.00031
Further Details:      
 
Domain Number 3 Region: 48-142
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.14e-21
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0038
Further Details:      
 
Domain Number 4 Region: 191-273
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000000602
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0099
Further Details:      
 
Domain Number 5 Region: 760-844
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.000000000981
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0085
Further Details:      
 
Domain Number 6 Region: 597-712
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000000507
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0071
Further Details:      
 
Domain Number 7 Region: 145-189,281-334
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000000785
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153004555|ref|YP_001378880.1|
Sequence length 1118
Comment acriflavin resistance protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MTEPKYGLAGRLARPFLRSKLTPVIVLASILLGLVAVALTPREEEPQIVVPMVDIMVPMP
GATPSEVESQVVTPLERRLWGIPGVEYLYGSSRPNVGFITVRFKVNEPLEPSLVKVHQEL
GAHPELLPAGASPPVVRALTIDDVPFLTVTLHGREALPAGELRKLADEVARELADVERTA
QVRVAGAARRVVRIEPDPARLRTLDVSLGELHRSLESAQAQLPAGAIVQGGERVELEARG
FARSAAELRRVVVSVRQGRPIYVEDVARVTDGPEPEPAVILTASKERPEFEQAATIVVAK
RPGTNATELAEKVTAKLDRLRGGLIPGSVDATVTRNYGETAGEKSNELIEHLLIATLSVI
ALILVAMGWRSALVVGIAVPVTLALTLLLTYLNGYTLNRVTLFALIFSIGILVDDAIVVV
ENIHRHMHLPGPRRSFARVVLDAVDEVGNPTILATFAVIAAILPMALVRGLMGPYMRPIP
VGASVAMIFSLVIAFVVSPWAALKIFRKQARLPETDESGLHPADPESAAPEPTVEPHANP
DTAPEGRLARIDRRVVRWLLGTGKVRIGFLAAVGLLLLAASALLVTGAVEVKMLPFDNKR
EFQVQLDLPAGAAREEALALGQQVARELLAEPEVESVQVHSGVAAPFTFVGMVRHSFMRE
LPEQVDLQVNLLPKQDRDASSHAIAVRVRPRIEALAHPKDARVKVVEIPPGPPVLATMVA
EVYGSTAAERERIAGEVRRAFDSVPGIVDVDSTLNPTSPKLGLSVDREKAALHGVAPAHV
VQTLSAAGYGAPLGTFHVERGAAQVPLVMQLAPEHRSRLDTLLALTVPGARGLVPLSELV
RVEEMREAPEIQHKNLKPVSYVTADLAGEIESPLYALLALGHELEGLRGDRGEPVARYGL
AHPADTERPSIKWDGEWHITLEVFRDLGLAFAAVMLLIYVLMVGWFQSFSMPIVILLPVP
LSLIGILPAHALGGTFFTATSMIGFIAGAGIVVRNSIILVDFAELKLREGMPLAAAVEEA
VLVRFRPMALTALAVIVGSAVMLADPIFQGLAVALMAGAVAATLLSRYAVPVLYYMLARR
GRAAELQREGARGRTEEERERRPPPPLEAALAAGGDVY
Download sequence
Identical sequences A7HB00
WP_011986002.1.20576 404589.Anae109_1692 gi|153004555|ref|YP_001378880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]