SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004589|ref|YP_001378914.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004589|ref|YP_001378914.1|
Domain Number 1 Region: 38-141
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0000000000000838
Family TM1287-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153004589|ref|YP_001378914.1|
Sequence length 144
Comment cupin [Anaeromyxobacter sp. Fw109-5]
Sequence
MGGWLRYGRALAALTGRKDMAGQDLFEAARHLAASVAMAKLPRAGGKRYETVFRHGSLQI
EIFAPRGRDTQRPHDRDEVYVVVRGSGFYVNGTQRFAFRAGDVMFAAAGEVHRFEEFSED
FFTWVLFYGPQGGERAPEPPAEPR
Download sequence
Identical sequences A7HB34
gi|153004589|ref|YP_001378914.1| 404589.Anae109_1726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]