SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004717|ref|YP_001379042.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004717|ref|YP_001379042.1|
Domain Number 1 Region: 432-592
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.3e-41
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 2 Region: 362-439
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000392
Family Homodimeric domain of signal transducing histidine kinase 0.0071
Further Details:      
 
Domain Number 3 Region: 288-336
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000654
Family HAMP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153004717|ref|YP_001379042.1|
Sequence length 600
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MTLQRKLALFLLAASLAPVVGVGFPILGWAQRELGRRASAEHLARARSGAASISADLAQV
DATLSTVAESWRPDRLDEADRRGLLLVLSRQLPAVEASAIVDGEGTTRALLSTRGGAAEE
GFLAAVRAAREGTGRGLSLHAYEEAGGGVRLAAVRAIPAADGGRWLVAVRLGTSVVQRRL
DAAVPEDGAAYLASGTRLLVTSVRAEPLTEAARGELAERIDRKRAGALLGRSSLAAWAPL
AAAPGWSVVVGVPAEVAYAPIVGLRHAALTACALVALGVLALSALLARRISARVARIDAA
VRALGEGEVEVRLPEEGRDEIAAVSRTFNAMAEELGSARARLERWNDDLQREVDARTREL
REAQAQLLEAQKLAAIGQLGAGAAHEINNPLTGILGNAQLLLEAMPRSNPDRESVEKIEA
LARRCRDITQKLIRFSQQRAEPDFRELDANRVVAEALALVDGHLRAGGIPLDVSLAEPSP
RVKGDPGHLAQVVLNLLSNARTACAGRPGAGIRIATRRAGGDVEIVVSDGGKGIAPEHLP
RIFEPFFTTKDQWSNVGLGLSVSYRIVAEHGGRIDVESRAGEGSTFTVRLPAASAAATAA
Download sequence
Identical sequences A7HBG2
WP_012096636.1.20576 gi|153004717|ref|YP_001379042.1| 404589.Anae109_1855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]