SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004732|ref|YP_001379057.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004732|ref|YP_001379057.1|
Domain Number 1 Region: 290-449
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-38
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 223-300
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.12e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153004732|ref|YP_001379057.1|
Sequence length 462
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MARPEGTPSQLRWPGLPARIAIGFGAALVSLAAASGASYVALSARDSASALVRHTAEAQH
AIEELESALLVSDVALRAHVEDHDPRHRDLFQSGWSKVLPALADLQRISEAHPEQKPRIA
RIAEAVDEIRAEQARLVALVDAGDLPGARALETANAAREVLEGAMTMLGRIDEDEQRAHE
GREAAWKRTVLVSNAVFVAAVGVLLVLILLAARLVRDDIRTREAARADRERTLVVQRRLM
AVVSHDLRNPLGAILTAAWALARLELPPNAGAMVRRIVSSGRRMERLIRDLLDWSRLQAG
GSVPIATREADLFDACQRITDELRDRDGKLIHLERDGDTRATFDPERIEQVVGNLLSNAL
RYAPPGTTVLVRAVGTPQEVRLEVHDEGPGIPSEAQARIFEPFRQGPSGHGTGLGLGLFI
VRSVAEAHGGRVHLESAPGKTSFVVHLPRCVAALGGEGGATR
Download sequence
Identical sequences A7HBH7
gi|153004732|ref|YP_001379057.1| WP_012096651.1.20576 404589.Anae109_1870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]