SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004867|ref|YP_001379192.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004867|ref|YP_001379192.1|
Domain Number 1 Region: 200-374
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.45e-45
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 390-509
Classification Level Classification E-value
Superfamily CheY-like 1.18e-30
Family CheY-related 0.0016
Further Details:      
 
Domain Number 3 Region: 132-212
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.92e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 4 Region: 9-116
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000266
Family Flavin-binding PAS domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153004867|ref|YP_001379192.1|
Sequence length 522
Comment PAS/PAC sensor hybrid histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MMNLLAQQLRVSALQAEVSRFQRFAKDAPIGILFISSDATVQFANDEYLRIVGRSREEFD
ADRFREGQGRPPEWLHPELGTRHESEYVRSDGTRVPLLVGLSVQPDGVAAFVIDLTAEKA
AERGRQESEERYRAIAEQLAEADRRKDEFFRILSHELRNPLAPIRNALHLLGRAPDDPAR
AARWREVIERQVGHLSRLVEDLLDLTRITAGRIQLRREPLDLAHVVGHTAEDHRAGFEAI
GVRLVLQLPPAPVPVEGDETRIAQIVGNLLANSAKFTPDGGTVTVRVAEAPGRSALLDVR
DTGEGIEAEVLPRIFEPFSQADRTLARSRGGLGLGLTLVKRLVELHGGTVVVTSAGPGAG
TEVAVRFPLAATPRVPAPQVGSGSGARGAATVLVVEDNLDAAETLRDALELEGMEVSLAP
DGEAGLAAARRRRPDLVICDIGLPGKLDGYGVARAFRADPALRDVRLVALTGYAGPEDRT
RAYAAGFDLHLGKPAALGELLRAIAPLVRPGTGGDGAAREPR
Download sequence
Identical sequences A7HBW2
gi|153004867|ref|YP_001379192.1| 404589.Anae109_2005 WP_012096787.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]