SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004917|ref|YP_001379242.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004917|ref|YP_001379242.1|
Domain Number 1 Region: 289-340
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000166
Family AraC type transcriptional activator 0.019
Further Details:      
 
Domain Number 2 Region: 236-287
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000272
Family Tetracyclin repressor-like, N-terminal domain 0.049
Further Details:      
 
Weak hits

Sequence:  gi|153004917|ref|YP_001379242.1|
Domain Number - Region: 77-132
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.0165
Family TM1287-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153004917|ref|YP_001379242.1|
Sequence length 345
Comment helix-turn-helix domain-containing protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MSLAPDQLTETPFRRAVPGPAALDVLSDALRVVRASGALLLRGEFTGSWAVATPDSSAIA
RIVCPGGARLAIMHLLAEGDCWIALPGRERVRLATGELVLFPRGDAHLLGSGDHAAVVPV
SALLPPAPWTELPVLRHGGGGERARIVCCYLRCDDLLFTPFLEPLPPVLHLRADGGSTHE
WVSASIRYVIAESTRGGPGSGALVGKLTELLFIEALRREMCSLPETSVGWLAALRDEYVS
RALQAFHARPGRAWTVEGVAREAGLSRSALVARFQRVLAKTPMQYLTTWRLQLAANRLLA
TSETVAAIAHAVGYGSEVALSHAFKRVTGVSPAAWRRSHRRSGTT
Download sequence
Identical sequences A7HC12
gi|153004917|ref|YP_001379242.1| WP_012096837.1.20576 404589.Anae109_2055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]