SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004950|ref|YP_001379275.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004950|ref|YP_001379275.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-50
Family DNA gyrase/MutL, N-terminal domain 0.00000349
Further Details:      
 
Domain Number 2 Region: 411-600
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 2.88e-43
Family DNA mismatch repair protein MutL 0.0066
Further Details:      
 
Domain Number 3 Region: 193-327
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.96e-29
Family DNA gyrase/MutL, second domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153004950|ref|YP_001379275.1|
Sequence length 601
Comment DNA mismatch repair protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MPRIQVLPPGLVNQIAAGEVVERPASVVKELVENALDAGATSVSIDVEEGGLALVRVADD
GCGMSADDAQLALERHATSKLRDAEGLAAIATMGFRGEALPAIASVARFRLDTAPAEDGA
GTRVEVEGGGRPSSGPVARPRGTTIEVRDLFFNTPARRKFMRAAATESGHVTEAVVRLAL
ARPDVGFTLRSAGRLVLGSRAGAAAADRAAQALGRDAHRHLVPVDAGRGNVRVRGLVCSP
DHSEATGRALYLFVNGRYVRDRGAAHAVLRAFAGTLPPGRHPAGVLFVELPLDRVDVNVH
PQKLEVRFAEAREVYDALFHAIAGTLRTAPWLAHGRAGGSAPPGPVALTPPGGAGSDETA
AVLAWAREAHAPEGSGALVPPPSPVPGASGTFAFAIPDEAGLARPAGYFASLRYVGQHAR
TYLLCEAQGGTLVVIDQHASHERLLFQRLREVFRTRKLPVQPFLLPQVVTLPPAVARALE
GGLPELARLGFDVEPFGGDSFAVKGAPAALAGVDLEALLLDLSAQLELVGSGTAVDEALH
DLLATMACHAAVRANQEVAPEEARALLDGLDAIDFKARCPHGRPVVFELPLAELERRVGR
R
Download sequence
Identical sequences A7HC45
404589.Anae109_2088 gi|153004950|ref|YP_001379275.1| WP_012096870.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]