SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005003|ref|YP_001379328.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005003|ref|YP_001379328.1|
Domain Number 1 Region: 323-486
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.98e-45
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 255-335
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000334
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 
Domain Number 3 Region: 126-259
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000075
Family Heme-binding PAS domain 0.083
Further Details:      
 
Weak hits

Sequence:  gi|153005003|ref|YP_001379328.1|
Domain Number - Region: 25-125
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.00249
Family Multidrug efflux transporter AcrB transmembrane domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153005003|ref|YP_001379328.1|
Sequence length 502
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MAERFRIPAPPRLPPLAASAVAIGLPLLMFALDSVFRVLLEGVPFVLFLLAVALASWVGG
LVPGLVSVALSAALGYAFLRGSADPATVSGAHLAIAVFIPAAAVITAIGAAARAGFRERE
RVAETLRRSEARERAKAEELQAIMDAVPAAVLIAHDPDARTLTGSRAAYDLLRVPPGVNV
SKSGERPPVHYRVMRNGKELSPQELPTQVAARSGARARDVEFEIVFDDGTRRTLLGNAEP
LFDDQGRSRGAVSAFVDVTKLSEAVRTRDAFLSMASHELKTPITSLQLQVGSLLRAREGV
PAPVAKAADATRRQVVRLTSLVNTLLDVSRLNEGRLQLEIEPVDLSALVSEVASRFVAET
ERSESRIRVDAAEAVCGRWDRLRLEQVLTNLLSNALKYGEGKPVSVRVQSDGATARLAVV
DHGIGIAPSEQRRIFERFERGPATRGYGGFGLGLWITREIVSALGGTIHVESAPGAGSTF
RVELPVTGPAAGASASERGDPA
Download sequence
Identical sequences A7HC98
404589.Anae109_2142 gi|153005003|ref|YP_001379328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]