SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005096|ref|YP_001379421.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005096|ref|YP_001379421.1|
Domain Number 1 Region: 550-712
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.1e-44
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 34-175
Classification Level Classification E-value
Superfamily CheY-like 1.57e-35
Family CheY-related 0.0022
Further Details:      
 
Domain Number 3 Region: 479-561
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 
Domain Number 4 Region: 190-313
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000523
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 5 Region: 357-484
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000265
Family GAF domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153005096|ref|YP_001379421.1|
Sequence length 716
Comment multi-sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MASTRELSLSPENDDREGHAPGVRGRGPATQPARVKILAVDDRAENLLAIESVLGTAEYE
IVKARSGADALRFLLRDECALILMDVQMPHMDGIETAKLVRANERTRAIPIVFVTAMSDE
ERYVARGYDAGAIDYLLKPVDPDVLRAKVAAFVELHRAKQEIVRQAALLAEQEKRERQRA
LAQLELKNLRRERAAQERYRRLVEGITHAIVWTADPATLACTFVSPAAEKLTGHPVDRWT
SGPDHWLTLLPDSARARLLDAIRGLAPGAEGVSIEHELVCADGRMLRFETEVRLVPSEEE
GRLEVRGFSVDVTVARLAEETLEFLDRAGAGLAESLDLATTADVAARIGVPFLAAAAVVH
VDAVDALPAILAVAHRDPSRDGLLRDLVRDAPLARPREDGRPEVLDDARPLLSAQAAASA
EALLGPGPIRVVSVALRGRDRVVGALQFLAVPHLDARALRLAEELGRRAAQAIDHALVYR
AAQHAVSVRDEFISIASHELRTPLTPLHLQMKALQRAVSALQGSPRREALLDRLGTCARQ
VDRMTRLVANLLDVTRLHAGRLEVEREPFELGELVADLAGRFRDELTRSGRLLELQLEPA
VHGRWDRLKLDQVLTNLVSNAVRYGGQGPVSVTLRREHDDAVLVVADSGIGIAPDDVALV
FDRYHKGTNSRAHGGLGLGLYITRRIVEAHGGTIGVESRLGEGSVFTVRLPLDGAR
Download sequence
Identical sequences A7HCJ1
WP_012097019.1.20576 404589.Anae109_2235 gi|153005096|ref|YP_001379421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]