SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005213|ref|YP_001379538.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005213|ref|YP_001379538.1|
Domain Number 1 Region: 222-404
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-35
Family Histidine kinase 0.00094
Further Details:      
 
Domain Number 2 Region: 3-157
Classification Level Classification E-value
Superfamily CheY-like 4.98e-23
Family CheY-related 0.0035
Further Details:      
 
Domain Number 3 Region: 153-233
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000192
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153005213|ref|YP_001379538.1|
Sequence length 418
Comment response regulator receiver sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MPRRVLCIEGDAEVRARVKTRLEREGFTVDTSASGLEGIERALTSRPDLIVADVHLPDLE
GFELTARLKREKALEHVPIVAVGESRDEHDDAIAAGADGFVDRAADDGQLGAELLEYMDG
KRERLTEQGERERLRTLSGTMAAHLEAALTGARRANARLLELDELKSAFMHNLAHELSTP
LTPLAGYLRILSSEKLGPMSPQQKRIVDSMIHSVTRLARVVDNLSDFASLQAGESPIMEG
AVNPDQLADEVVAEQRPMIRDARLHVVVAHAGGEPVIADPRKLRQAIANIVSNAVKFSPH
GGEVLVEVTRQPGKLRYTVYDQGPGIRSLEQERIFEPLHHARARGTDEARLPGSGLGLPV
ARRIAEAHGGRVWVESPPRTQPGSLARQFTGSKFVLEIPVRPADQPTAGKAPSAASLA
Download sequence
Identical sequences A7HCV8
gi|153005213|ref|YP_001379538.1| 404589.Anae109_2352 WP_012097141.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]