SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005226|ref|YP_001379551.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005226|ref|YP_001379551.1|
Domain Number 1 Region: 567-729
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-36
Family Histidine kinase 0.00072
Further Details:      
 
Domain Number 2 Region: 3-122
Classification Level Classification E-value
Superfamily CheY-like 9.25e-30
Family CheY-related 0.00065
Further Details:      
 
Domain Number 3 Region: 131-247
Classification Level Classification E-value
Superfamily CheY-like 1.15e-26
Family CheY-related 0.0038
Further Details:      
 
Domain Number 4 Region: 265-400
Classification Level Classification E-value
Superfamily CheY-like 2.42e-18
Family CheY-related 0.0024
Further Details:      
 
Domain Number 5 Region: 498-578
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000569
Family Homodimeric domain of signal transducing histidine kinase 0.0053
Further Details:      
 
Domain Number 6 Region: 406-508
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000611
Family Heme-binding PAS domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153005226|ref|YP_001379551.1|
Sequence length 734
Comment multi-sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MTAVLVVDDSLTVRMDLEEAFSSAGFETVLAADVASARRALAARRFGLAVLDVLLPDGDG
LELLAEIKRSPEHGAVPVVLLSTEAEVQHRVRGLQTGADEYVGKPYDSAQVVARARELVR
RRGDAAGGASRPVLVVDDSVTAREELRAALEHAGLEVVTAGSAEEGLLLAAELRPRAIVV
DGVMPGMDGAAFVQAIRADAALRTTPCILLTASGSVGELRALDAGADAYVRKDEDGNELV
LARLQALLRSATSATSVAAPGALPAPRRILVVSAGASTLLSDVAEALRQEGHDVVSATSP
EEALALLAVDRVDAILVESTRAGEEGAAACLRIRGDGRWRHLPVLVLGARAEPEATVEAL
AGGADDYVPVASGPLVARARVNAQLRRSQFEDENRTREGYVRSAAILETISDAFFAVDRD
WRFVYVNHALESMVRAERDAIAGTTLWDQCPFLARGGGARAELERAIDSQVPVTFEARGP
GDRWIEVRAFPHRDGLTAYLRDVTERRRTQEVQAHLLGITGHDLRTPISVVRVSVDVALR
DAQLSERNRRVLSRAAGAAARMSRLVNDLLDYSRARLGKGIPIAPRPSDLDAICRDIIEE
VSSAHGGRRIAYQPGVDGAGEWDPDRIGQVLSNLLTNAVRYSPEDAAVSVAWHALDDRRV
ISVHNEGPPIDQALLANLFEPFERGRTAASGGTGLGLFIVREIVRAHGGSVAVASDAGSG
TTFSVSLPARAGGG
Download sequence
Identical sequences A7HCX1
404589.Anae109_2365 gi|153005226|ref|YP_001379551.1| WP_012097154.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]