SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005351|ref|YP_001379676.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005351|ref|YP_001379676.1|
Domain Number 1 Region: 473-623
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.17e-46
Family Histidine kinase 0.0031
Further Details:      
 
Domain Number 2 Region: 27-200
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000000000000235
Family YkuI C-terminal domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 397-474
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000353
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 
Domain Number 4 Region: 338-387
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000262
Family HAMP domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153005351|ref|YP_001379676.1|
Sequence length 626
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MLLVAIPSLLAFSLLVRGAAGDLLRGRTEAHIQTVAQSSARGVEELVRRGEHSALALATS
TSIVRALGELEDGRADTASVAALGESFLAAQRLDPAIQAVRLVDVEGNEVVKAREGELTP
AHSPVHGPLGLPAIQSLRGRPFFEEALRAPRGSVTISDLERGRVEGEEDWCPAMVRFATP
LFFQSGARAGVLIVNVWGAEVGAMLNRLVPAEQGAAFLVERNAAAPDRSGVYLFHQDGQC
EFGNQTGSRVTAWQQYPRELVDSWMKTDAGIAMDPRTGDLLAHVYYSPYARPDRGWVVVL
AAREAYFARPLERLQASVLGLSALVVAGTVVAALLLSRTLTQPLRTLAAGVRAIGDDLSV
RVPVRGGREVAIVAESVNRMAGALQEHLETRERSERQLRETEKLASIGEMAAGLAHELNT
PLSNIRALASLARRDLDAGRVELQALKADLADVADQTRRCTTIIDGLLRFARRQPPALAA
HDVNRLVHGSLALVRLRAEKKGVTLAFEAGAAQAAVVDAAQLEQVFVNLLLNAVDAARPG
GRVEVSTATAGGRIAVRVSDDGAGIAPEHLPRIFDPFFTTKAVGEGTGLGLSVSYGIVRN
HGGALSVDSAPGRGATFTVSLPLGTP
Download sequence
Identical sequences A7HD96
404589.Anae109_2491 WP_012097284.1.20576 gi|153005351|ref|YP_001379676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]