SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005457|ref|YP_001379782.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005457|ref|YP_001379782.1|
Domain Number 1 Region: 280-442
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.11e-41
Family Histidine kinase 0.00045
Further Details:      
 
Domain Number 2 Region: 210-287
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.89e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 
Domain Number 3 Region: 89-219
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000611
Family Heme-binding PAS domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153005457|ref|YP_001379782.1|
Sequence length 448
Comment PAS/PAC sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MTSGPSQRAGAPGATLPELSRTPRWRRRLPWSPGRIVGAYALVASLWIGLSDRVVEAVVG
DHARTALQTAKGIGFVLVTSALLYALIHRREHGLRLRGAEIRATIESMADAVLVVDTRAQ
IVEVNKAAAELLRVGARTELLLPLQEWGRRFQLRYLDGSPVPYERFATVRALSGERVPAY
DGIVRAADGRDVFLSVTAAPVLVSGGRTELAVAVLRDVSAARRLDELRDEFLSTAAHEFK
TPLAVIKAYAQLLQKREPAEAQALVVIQRQVDRLNRLVQHLLDTTRLRLDVRDERLHRFD
LGALADEVVGRMRGSAPAHDITVSSVPAPVRADRERLARVITSLVDNAIRFSPRGGPVAA
RVEARDGAAVFSVEDRGLGIAPERQARIFERYYRAHAGTPQDYGGLGLGLDMSREIVARH
GGRMWFESTPGHGSTFHFSVPLADEGAP
Download sequence
Identical sequences A7HDK2
WP_012097393.1.20576 404589.Anae109_2597 gi|153005457|ref|YP_001379782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]