SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005682|ref|YP_001380007.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005682|ref|YP_001380007.1|
Domain Number 1 Region: 333-495
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-43
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 257-345
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000235
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 
Domain Number 3 Region: 203-252
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000222
Family HAMP domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153005682|ref|YP_001380007.1|
Sequence length 501
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MKSLTRAIFVQTVVLAFVIGAALAFLGWESARQARALERDANQVRVATALALALTDAAHE
EERWISSLASRSAALQETRIAEAGEHVARRSTDIEAFPLSPRAAEVWTQFVGSRRALRPY
TEEVVAAARRGDPTAMTLALDKWRLMNARADLLLSNFTAYHLNRLDRTVADLQRRRTRTL
ALAGAAVAAALLLAAGFAAALSRKVVLPLVEMASTANRIQATGTATPVAGAERRDELGVL
ARAFNDMTGRLVSANTTLAGANASLAEAVRARDEFISIASHELKTPITPLALRVQHLLRI
AREAQHGLVPREQLVRVTRNLDTHVVKLSKLVENLLDVSRINSGQLALRMEDFPLAAAVG
DALDRVSEELSAASCDVRVEGATDVIVRGDRSRVEQVLVNLLGNAAKYAPGGPVVVRVAA
SADVVEVEIEDAGPGITPQDQQRIFERFERAAADRHVSGLGLGLYIAREIVQAHSGELSV
RSEPGRGATFAMRFRRASPGS
Download sequence
Identical sequences A7HE77
WP_012097624.1.20576 404589.Anae109_2823 gi|153005682|ref|YP_001380007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]