SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005737|ref|YP_001380062.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005737|ref|YP_001380062.1|
Domain Number 1 Region: 330-566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.85e-66
Family Extended AAA-ATPase domain 0.00000437
Further Details:      
 
Domain Number 2 Region: 8-193
Classification Level Classification E-value
Superfamily PrpR receptor domain-like 6.41e-45
Family PrpR receptor domain-like 0.0000388
Further Details:      
 
Domain Number 3 Region: 546-646
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000512
Family FIS-like 0.051
Further Details:      
 
Domain Number 4 Region: 206-295
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000324
Family Heme-binding PAS domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153005737|ref|YP_001380062.1|
Sequence length 648
Comment sigma-54 dependent trancsriptional regulator [Anaeromyxobacter sp. Fw109-5]
Sequence
MAIDADRRPIVWAFSTSRLRHVFESVAPLLADVAEVRVFDKGFEEALQVSRALVEAGEEV
DAFVAAGSNGAYLRDHASVPVVVVMASTLDALQALVQARKLSNRIAVVNFRRVVAGLEQG
IGLMEDTTIVQRPYVTPEDAKAHVADLAAQGFGVVVGPGPVCDLAERAGLPSVLLYGQDS
LSEAIRHAAEVAHIARAAEAKRLDVERVLRHLDVGVVAVDGEERIQTVNPALQRLLGVTA
PELTGRRLSAVAPELSLARVLETGTPELDVVQRLGSRTLVVSRVPLREGGAQRGALLTCQ
DAAVIQRLERGLRTEHRPPRFVARFDLGGLVGASPAIAGVRALAERYARTDATVLITGES
GTGKEMVAQGIHRASRRRDRPFVAVNCAAFPETLLEAELFGHEEGAFTGARRGGRPGLFE
AAHTGTLFLDEIGDVPTTLQTRLLRVLQERQVLRLGSNHPTPVDVRVVAATHRDLRAATA
RGEFREDLFYRLNILPLHVPPLRERGEDVQAIAAELLKRALLRHGEPDAHPRALALVLPR
LAGYAWPGNVRELENVLERVAALFVDRGPRARIPEEELRAAIPELLARPGATPAAPAAPR
ADLRAARREQERAHVERVLAECGGNQAEAARLLGIGRTTLYRKLGRVR
Download sequence
Identical sequences A7HED2
404589.Anae109_2878 WP_012097680.1.20576 gi|153005737|ref|YP_001380062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]