SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005840|ref|YP_001380165.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005840|ref|YP_001380165.1|
Domain Number 1 Region: 288-487
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.05e-47
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000157
Further Details:      
 
Domain Number 2 Region: 787-1008
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 8.11e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000545
Further Details:      
 
Domain Number 3 Region: 40-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 8.37e-24
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0012
Further Details:      
 
Domain Number 4 Region: 135-180,266-322
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.28e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0047
Further Details:      
 
Domain Number 5 Region: 181-264
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.66e-16
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0034
Further Details:      
 
Domain Number 6 Region: 702-787
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000262
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0057
Further Details:      
 
Domain Number 7 Region: 553-646
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00000000034
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153005840|ref|YP_001380165.1|
Sequence length 1028
Comment acriflavin resistance protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MSPIRTFIRRPIFTSMLLLAVVVFGLVAYPRIGVDQMPEVDFPIVTVTTILPGADPETVE
ENLSKPLEEALNTLSGLDTLRSQNFESISMVVLRFDLSVPVDVAAQDVRDKVQATLSQLP
KEIETPVVQKLDLGAMPIVQLALSGPVPIQELTRIAEDELKPGLQRLQGVGSIDVVGGRE
REINVVVDPVRLRSYGLAATDVSQAISAQSIDVPGGRMLEPGLERVVKLETEARSVEELR
DLVVASPGGKQIRVRDVADVVDGPGEARSSATLDGRSAVALVVRKQSGANTVEVAERVKA
DLAALAQRLPEGSKLEVVTDNSKFIRGSISAVQHDLLIGAILAVLVVLVFLRDWRATIVS
AFALPTSVVGTFAVMHALGFTFNTVTMLALTLSIGLLIDDAIVVIENIVRHLEKGERPRE
AALNGTGQIALAVLAVTLSVIAVFIPVAFMKGMVGRFFFQFGVTVAVAVAISYFVSMTLT
PMMSARLLAKHGHGTTRVGAALERFFTGIERAYRRALEWALAHRGLTVASAVGVLVATVF
LGKFLQFTFIPSQDQSGVTVSVELPVGTPLLETEAQAERIAAQIRGVPGVVNVFALVGGG
VDEAVNKADLTVNLVHLKSRRYSQEEFKQHLRESLVVPPGAILSVADQQMMAGGGSRPQP
VQFNIRSDDWDALLAAVEKTKAAMEKNPGLTDVDSTYRAGRPLLSVQVDRDRAAAVGLPA
AALGQTLRAYLGQDAFATYREKGEQYDVKLRLPEATRADPDAIGALTLRTPRNELIELRS
VARLESGEGPSQIERQALKRQVTMVANLKGYSLGEAISFLNGVAKDFPPQVQTDFEGQGK
ELANTGREFLIALFLGIVLIYMILAAQFESLLDPVTIMLSLPLAVIGAIAALLLANEFMS
MLAMIGMIMLAGLVTKNGILIVEFTNQLRAEGRSTLEALLEAGPLRLRPILMTSIAMIAG
MVPVAFARGDGAEMRTGMAWAIIGGLAASTVLTLVVVPVVYALLDGLRRRLVRAVPSVRG
DDEGERAA
Download sequence
Identical sequences A7HEN5
WP_012097790.1.20576 gi|153005840|ref|YP_001380165.1| 404589.Anae109_2982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]