SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005901|ref|YP_001380226.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005901|ref|YP_001380226.1|
Domain Number 1 Region: 318-560
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.73e-67
Family Extended AAA-ATPase domain 0.00000189
Further Details:      
 
Domain Number 2 Region: 532-635
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000556
Family FIS-like 0.045
Further Details:      
 
Domain Number 3 Region: 182-278
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000112
Family N-terminal PAS domain of Pas kinase 0.065
Further Details:      
 
Domain Number 4 Region: 54-194
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000785
Family IclR ligand-binding domain-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153005901|ref|YP_001380226.1|
Sequence length 637
Comment Fis family GAF modulated sigma54 specific transcriptional regulator [Anaeromyxobacter sp. Fw109-5]
Sequence
MRDGELEGVRPEIARSWTRVRDLYRVDPALRRAPLDAGGEVLRRRGEDETFELARPVLAQ
LSARLGETGHALALLDAEGRVLSIGGDPHVVARLAELNLTPGASWREEVAGTNGAGTALA
ERRPVEVFASEHFVEAWHPWASAAAPIVAPGGELVGLVQVTGPWDTREPQGVVAAVAIAA
AVEERLRARAELRDELVRHALRAARSSGDGVVAVDARGRVLAANDAARRRLAFEGGELPR
STRERIVAALHGSEATREDELTVEWPGAGDERRRVVCSVVAHERRPVGALLFAAAPAGRA
SRGAARQRLAARYGFEAILGGSARLRTALDLAEVAARNDLPVVLHGESGTGKELFAHGIH
AGGARADEPFVALNCGAIPAALVEAELFGYEPGTFTGAQREGKAGRFEEADGGTLFLDEI
SELPPQAQTALLRVLQESEVVRLGGSAPRPVDVRIVAATNRRLYDQVETGRFRQDLYFRL
NVLHVDIPPLRDRSEDVPLLARAFLREAEERMGRAGLELSEESKALLLAHPWPGNVRELR
NVIMRAAAVASGARIEPADLRLGPARPAAAPARPAAPSPAVERPPQPLAAAEGEGPEREE
LVAALDASGWNIARTAASLGVSRMTLYRRLRKFGITR
Download sequence
Identical sequences A7HEU6
404589.Anae109_3045 gi|153005901|ref|YP_001380226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]