SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005929|ref|YP_001380254.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005929|ref|YP_001380254.1|
Domain Number 1 Region: 213-316
Classification Level Classification E-value
Superfamily IVS-encoded protein-like 0.000000000000602
Family IVS-encoded protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|153005929|ref|YP_001380254.1|
Domain Number - Region: 72-128
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0392
Family Multidrug efflux transporter AcrB transmembrane domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153005929|ref|YP_001380254.1|
Sequence length 317
Comment hypothetical protein Anae109_3074 [Anaeromyxobacter sp. Fw109-5]
Sequence
MTAVGGTGAKPTAASSGDAADARRRRPSGPLVGPFPWLVLLPRACPPRARGRHLVPSPAR
TDVTNDKVGVAVGVAVGVAVGVAVGVAVGVAVGVGVGVGVGVAVGVAVGVGVGVGVAVAV
AVAVTGRERRSHPGQARATGGWHCACGSRVHAPFGRTVFVRGLTVVGHGAAPSPGGERSR
PMANNLASLADAARSTVPSSRSRNSSPVRVLPHHKLHAFAVARDLLLAVLGSPIRDAKLR
DEAVRSAKSACLNTAEGAGRVTRGDKARAFAIARAETVEAAAAVEIAALCGDTSAAHAEE
VARIADRLVAMLTGLVR
Download sequence
Identical sequences A7HEX4
404589.Anae109_3074 gi|153005929|ref|YP_001380254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]