SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005946|ref|YP_001380271.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005946|ref|YP_001380271.1|
Domain Number 1 Region: 555-752
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.96e-28
Family Multidrug efflux transporter AcrB transmembrane domain 0.0051
Further Details:      
 
Domain Number 2 Region: 205-359
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.22e-23
Family Multidrug efflux transporter AcrB transmembrane domain 0.0052
Further Details:      
 
Weak hits

Sequence:  gi|153005946|ref|YP_001380271.1|
Domain Number - Region: 441-505
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 0.00334
Family Tetrapyrrole methylase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153005946|ref|YP_001380271.1|
Sequence length 776
Comment exporter of the RND superfamily protein-like protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MSRSRLERVFGTVVALRGPILVLYALLVPAAAWLAAGIPSEGAIDRLVVPSDPDFVATRE
LQRIFPERPLVVLLLEAEDPYRPRVLAQASAIEAALRALPGVTPVSILDAYARARGGAPP
LEDPATAKALRRFATGTDFFRRQGLVGEGFLGVVVTFEATTPPARDAALAAIDRAVEGAR
GDAIARVRRVGGPYLESWIERESRDASRRHFPVFGLLVVAVALFLYRSWRALLAILLTLA
AAVALAAGAGRLLGFSFTVVSAIVPLTVMVTTLASLVYLHSRFVDQPEGVPVEAHQLAAL
AGKFLPVTASSAAAVAGFAALAVSRIRPIREMGLWTAAGLAIAWVVALTLFPALQRALRT
PTRRSVEIRARLYERVAGALPAFTWRWRRPLVAAALGLAAAGLVALVGVPGRVAPMEVGL
DVLRYVDPSLPIHEDMLFFRRHVSGLNVARLWVRTPPGAITDPEVLRALDAFTTRVEAIP
GVSSVVGPTSLLRLRRYAAGEPEALPRDPAAFAEAVADLEQLLLSEPELRAFVDVGTLAN
AQLTVVFERGDGPGVAALARAAREAWDRTAAEAPALRGAELRVAGESILAGKVGASLVPT
LTESFAITAALVFAAFLLVFRSASARLLAMIPSLFAILVTFLAMRLAGGSLDVATILVAT
TVLGTTENDQIHFFHHLHEGEGSGGLDGALRHTLRVSGRAIVFATFINAAGFLALALSGF
PPLRQFGVVTAGAFLLAMIADFTALPAALWIARGEAPATAPPPGRGASPRRYGWRA
Download sequence
Identical sequences A7HEZ1
gi|153005946|ref|YP_001380271.1| WP_012097902.1.20576 404589.Anae109_3091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]