SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005990|ref|YP_001380315.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005990|ref|YP_001380315.1|
Domain Number 1 Region: 5-277
Classification Level Classification E-value
Superfamily RmlC-like cupins 3.82e-91
Family Pirin-like 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153005990|ref|YP_001380315.1|
Sequence length 279
Comment pirin domain-containing protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MTERRVLEVITPVVASDGAGVRLKRSIATERLDHLDPFFLFDHFGSENADDYVAGFPLHP
HRGIETITYMLDGSVAHRDSIGNSGVVGPGDVQWMTAGSGILHEEMPKMGPRRLDGFQIW
VNLPRELKMTRPRYQDVPAARIPEVVRPDGARVRVVAGHVDGVDGAVKEIFAGPTYLDVS
LPADGSFEHPVPRGHTALVYVFQGEVTAGGKAVGAPRLAILGDGDVVRLRASGGPARFLL
LSAQPLEEPAVRWGPFVMNTQEEIRQALQELRDGTFIKA
Download sequence
Identical sequences A7HF35
gi|153005990|ref|YP_001380315.1| 404589.Anae109_3135 WP_012097948.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]