SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005991|ref|YP_001380316.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|153005991|ref|YP_001380316.1|
Domain Number - Region: 65-154
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0392
Family Multidrug efflux transporter AcrB transmembrane domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153005991|ref|YP_001380316.1|
Sequence length 184
Comment hypothetical protein Anae109_3136 [Anaeromyxobacter sp. Fw109-5]
Sequence
MVTTDRFADTRGAGKAAAAWGLIGVTALLLNAVVRLTPVAVQGFAAYRLEAWQWALAAGN
VAFMGYFEGYRGFQQGFAPRVVARALHLARHPRPLHVALAPLFCMGLFHASRRRLVTSWT
LLLSIVGIVLAVRTIAQPYRGIVDAGVVVGLGWGLAALAASAWRAMAGDPPRVSPELPVS
TPSR
Download sequence
Identical sequences A7HF36
WP_012097949.1.20576 gi|153005991|ref|YP_001380316.1| 404589.Anae109_3136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]