SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006043|ref|YP_001380368.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006043|ref|YP_001380368.1|
Domain Number 1 Region: 209-363
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.22e-31
Family Histidine kinase 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|153006043|ref|YP_001380368.1|
Domain Number - Region: 144-180
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00294
Family Homodimeric domain of signal transducing histidine kinase 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153006043|ref|YP_001380368.1|
Sequence length 365
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MLHEFLTQHRDAIIERARARVAERRVPLASPAELALGVPMFLSQLTDLLREEQRAPPRGP
TATTDERAEEAVGASADEHGNDLLRGGLTVAQVVEGYGDLCQAITEHAARTKAAITVEEY
RTLNLCIDVATARAVTAFSDARDRRTEKQETERLGMLAHELRNLLSSAMLAYQALKGGAV
GIEGSTGALLGRSLRGLRDVIDRSLAEVRLDATLRNPERVVLAQFIEELEVGAALDAKER
GLELSVAHVDRAIAVHADRQLLASAVANLVQNAIKFTRPGGRVSLTVQQESGTMLIHVED
QCGGLAEGHAETMFGPFDRRQANRRGLGLGLKISRDAVEADGGEIRVRNLPGKGCVFTIA
LPAAA
Download sequence
Identical sequences A7HF88
gi|153006043|ref|YP_001380368.1| WP_012098001.1.20576 404589.Anae109_3188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]